PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g26120.1.p
Common NameBRADI_2g26120, LOC100825401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 457aa    MW: 53623.3 Da    PI: 6.4168
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g26120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.11.2e-22234322191
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       +f+  Y ++vGF v+k++s++s+++g++ + +f+C+k+  + +++++ +++rr+++ +rt+Ck  +++kk+ d kw+v++++l+HnH+lap
  Bradi2g26120.1.p 234 RFFTVYERRVGFAVKKDSSYRSRKTGQVQRIEFTCNKHRGHINTDSA-TRQRRSNKIERTECKVLMRLKKD-DCKWVVYSVNLQHNHDLAP 322
                       59***********************************9988888888.89********************9.9***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-19234322IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MDIMGSHLVD GVIGQNSQVM DRVSFRTKQF TKPRTLELFV ESFVMRRRIR EETQSIQELE  60
MVQSMLDGTD THVQHGGVDS ASQEQDKTIM GRQENEQRQE NMGAPDAAVN RRKPDCAPMP  120
FDLNANLFEN GNEEEEYLER SHDDVEQNSE VQFPEQSYEH AEMTDEATNH VQFADQARDD  180
QGIEEGLFPD PVTNEEKEMD RMFEADNYPA IHEIIQARAP QDGMVFDSLE EAFRFFTVYE  240
RRVGFAVKKD SSYRSRKTGQ VQRIEFTCNK HRGHINTDSA TRQRRSNKIE RTECKVLMRL  300
KKDDCKWVVY SVNLQHNHDL APSQWLVRFM SCHKKMSPAD KHLVEILQES RVPPRKVMSI  360
FRSMRGSFRN IPFDAKYVSN MMYQERLKHK NRDIKELLQK FKDVQKKTKS FYYTLQIDED  420
NNVRSVFWTD VMGRADYKMF GQFLSFTTYT ICPLHH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566270.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLI1HJP20.0I1HJP2_BRADI; Uncharacterized protein
STRINGBRADI2G26120.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-27FAR1-related sequence 5